PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009592237.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 296aa    MW: 32647.5 Da    PI: 7.3873
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009592237.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.37.5e-081057347
                     SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqky 47
                      W++eE++ + +a++++  +    +W++ a+ ++ ++t  ++k ++q +
   XP_009592237.1 10 VWSKEEEKAFENAIAMHWVEdseqQWEKFAAVVP-TKTIDEIKRHYQLL 57
                     6*****************99**************.***********965 PP

2Myb_DNA-binding391.9e-12134178347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
   XP_009592237.1 134 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 178
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-4655IPR009057Homeodomain-like
SMARTSM007170.0015760IPR001005SANT/Myb domain
PfamPF002492.3E-61056IPR001005SANT/Myb domain
PROSITE profilePS500906.1911158IPR017877Myb-like domain
SuperFamilySSF466893.11E-81164IPR009057Homeodomain-like
CDDcd001671.45E-61158No hitNo description
PROSITE profilePS5129416.873127183IPR017930Myb domain
SuperFamilySSF466896.83E-17129184IPR009057Homeodomain-like
SMARTSM007172.3E-10131181IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.1E-17131181IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.3E-11132177IPR009057Homeodomain-like
PfamPF002497.2E-11134178IPR001005SANT/Myb domain
CDDcd001679.73E-10134179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MSVSDLPSEV WSKEEEKAFE NAIAMHWVED SEQQWEKFAA VVPTKTIDEI KRHYQLLVDD  60
VAAIDAGHVP LPNYIGEESS SSSNKETNLG YSGSVDRRSN SGYVNGFSGP THDPIGHSGK  120
GNSKAEQERR KGIPWTEEEH RLFLLGLDKF GKGDWRSISR NFVISRTPTQ VASHAQKYFI  180
RLNSMNRDRR RSSIHDITSI NGGDVSIHQA PITGQQPNPN PSNPAALGPN IKHRNQPNMH  240
GFGMYGAPMG HPVAAPPSHM ASAVGTPVML PHGHHPPYVL PVAYPIPPPH PPPMHQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592237.10.0PREDICTED: transcription factor DIVARICATA-like
TrEMBLM1A4210.0M1A421_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000143500.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA58012136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.17e-77MYB family protein